PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010941926.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family TALE
Protein Properties Length: 558aa    MW: 61868.3 Da    PI: 8.1235
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010941926.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.63.1e-113904271954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++++LAk++gL+ +qV++WF N R +
  XP_010941926.1 390 FEHflHPYPSDADKQQLAKQTGLSRNQVSNWFINARVR 427
                     564459******************************88 PP

2BELL115.72.4e-37251321272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     r e q+kkakLls+l+eVdkrY++y++q+q+v++sF+ v+g g+a+pYt l  ka+SrhFrc+kdai +q+
  XP_010941926.1 251 RFEYQRKKAKLLSMLDEVDKRYNHYCNQMQMVVNSFDSVMGFGAATPYTVLGHKAMSRHFRCIKDAINKQL 321
                     6799*****************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-57172319IPR006563POX domain
PfamPF075262.4E-46177317IPR006563POX domain
PROSITE profilePS5007113.313368431IPR001356Homeobox domain
CDDcd000869.86E-14371432No hitNo description
SMARTSM003895.3E-12371435IPR001356Homeobox domain
SuperFamilySSF466891.71E-17373438IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-29374436IPR009057Homeodomain-like
PfamPF059205.7E-20388427IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MSQGRYQGIT TCQGHQMEHH IAQQSRRDKL KVQGFEATTL HPLDQIEEKI LDLGTYEHAR  60
TGNILSDMFS FPTPRLANQI SGIDRLPQRP VAEFSGEWYG DNRQGVVMGS NFSSLGDTAA  120
DPATVQLLLM NMTSHEQHPR SATFGDGSFS GGMVENQGLS LSLSSSLHQL EMGGVSVIRN  180
SRFVRAATEL LEEACGVWRE QLKGRGSRRQ ICSSNPNHNP RFAGANGATS STVVGSSSSP  240
KYLPSLSSAD RFEYQRKKAK LLSMLDEVDK RYNHYCNQMQ MVVNSFDSVM GFGAATPYTV  300
LGHKAMSRHF RCIKDAINKQ LKQVHELLGE REVGSTSGIT KGETPRLRLL EQSLRQRRPY  360
HQFGMIESEA WRPQRGLPER SVNVLRAWLF EHFLHPYPSD ADKQQLAKQT GLSRNQVSNW  420
FINARVRLWK PMVEEIYQQE AKDKEAEGNK DRRETRPQSP SHHNSPLGQG PEANRPQSPA  480
VATAHQLSND DTILIGTDAP TSAVDLCGAD MEPMDDLCGA AAATALGSSV RLGASGDVSL  540
TLGLRHSGNP SEKHWFYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A4e-18377434158Homeobox protein Meis1
4xrs_B4e-18377434158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010941926.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-122BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM0TL801e-160M0TL80_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27440_0011e-160(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-108BEL1-like homeodomain 4